PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof014384
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 209aa    MW: 22447.5 Da    PI: 11.5074
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-102803PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-151357347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT++E+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky
        Sof014384 13 PWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVASHAQKY 57
                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.186662IPR017930Myb domain
SuperFamilySSF466898.22E-18963IPR009057Homeodomain-like
SMARTSM007179.8E-111060IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.0E-181161IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.6E-111256IPR009057Homeodomain-like
PfamPF002491.4E-121357IPR001005SANT/Myb domain
CDDcd001671.47E-101358No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
HGSTHASASP GVPWTEDEHR RFLAGLEKLG KGDWRGISRH FVTTRTPTQV ASHAQKYFLR  60
QSSLTHKKRR SSLFDVVENA DRAATSSIKD REQRLRLKDA IATTASAAAP GTTTPELPAL  120
SLGIISRPAR RPDYVALPPT SLSLQLPRYS AAMGSASPSL ALAAPKHHHP SSTLTAAAKA  180
SSSRALPDLE LKISPPGRVT PFLGTIRVI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.128932e-92bud| callus| crown| inflorescence| leaf| meristem| root| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455021.11e-102hypothetical protein SORBIDRAFT_03g003100
TrEMBLA0A059PYW31e-109A0A059PYW3_9POAL; MCB2 protein
STRINGSb03g003100.11e-101(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.16e-34MYB_related family protein